PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT4G36590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family M-type_MADS
Protein Properties Length: 248aa    MW: 28470.2 Da    PI: 9.6367
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT4G36590.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.61.2e-211462149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 k+ en+sn qvtfskRr g++KKA+EL++L +ae+++i+fs+ gk++ +
  AT4G36590.1 14 KKMENESNLQVTFSKRRFGLFKKASELCTLSGAEILLIVFSPGGKVFSF 62
                 5789******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-34665IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.656666IPR002100Transcription factor, MADS-box
CDDcd002655.73E-39783No hitNo description
SuperFamilySSF554551.83E-27794IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-19828IPR002100Transcription factor, MADS-box
PfamPF003199.4E-231562IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-192843IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-194364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0009046anatomyflower
PO:0009089anatomyendosperm
PO:0025195anatomypollen tube cell
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MVRSTKGRQK IEMKKMENES NLQVTFSKRR FGLFKKASEL CTLSGAEILL IVFSPGGKVF  60
SFGHPSVQEL IHRFSNPNHN SAIVHHQNNN LQLVETRPDR NIQYLNNILT EVLANQEKEK  120
QKRMVLDLLK ESREQVGNWY EKDVKDLDMN ETNQLISALQ DVKKKLVREM SQYSQVNVSQ  180
NYFGQSSGVI GGGNVGIDLF DQRRNAFNYN PNMVFPNHTP PMFGYNNDGV LVPISNMNYM  240
SSYNFNQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A4e-15795185MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B4e-15795185MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184198660.0
Genevisible246224_at0.0
Expression AtlasAT4G36590-
AtGenExpressAT4G36590-
ATTED-IIAT4G36590-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT4G36590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G27960, AT1G31630, AT1G65300, AT1G65330
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT4G36590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1412340.0AY141234.1 Arabidopsis thaliana MADS-box protein AGL40 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195377.10.0MADS-box transcription factor family protein
SwissprotQ9FKK23e-74AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLA0MFC40.0A0MFC4_ARATH; Putative uncharacterized protein (Fragment)
TrEMBLO232220.0O23222_ARATH; MADS-box protein
STRINGAT4G36590.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142941022
Representative plantOGRP1617761
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. De Bodt S, et al.
    Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants.
    J. Mol. Evol., 2003. 56(5): p. 573-86
    [PMID:12698294]
  3. Parenicov√° L, et al.
    Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world.
    Plant Cell, 2003. 15(7): p. 1538-51
    [PMID:12837945]
  4. Kofuji R, et al.
    Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses.
    Mol. Biol. Evol., 2003. 20(12): p. 1963-77
    [PMID:12949148]
  5. Lall S,Nettleton D,DeCook R,Che P,Howell SH
    Quantitative trait loci associated with adventitious shoot formation in tissue culture and the program of shoot development in Arabidopsis.
    Genetics, 2004. 167(4): p. 1883-92
    [PMID:15342526]
  6. de Folter S, et al.
    Comprehensive interaction map of the Arabidopsis MADS Box transcription factors.
    Plant Cell, 2005. 17(5): p. 1424-33
    [PMID:15805477]
  7. Pina C,Pinto F,Feij
    Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation.
    Plant Physiol., 2005. 138(2): p. 744-56
    [PMID:15908605]
  8. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  9. Day RC,Herridge RP,Ambrose BA,Macknight RC
    Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation.
    Plant Physiol., 2008. 148(4): p. 1964-84
    [PMID:18923020]
  10. Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC
    An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis.
    Plant Physiol., 2010. 154(1): p. 287-300
    [PMID:20631316]
  11. Ito J, et al.
    Analysis of the Arabidopsis cytosolic proteome highlights subcellular partitioning of central plant metabolism.
    J. Proteome Res., 2011. 10(4): p. 1571-82
    [PMID:21166475]